Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tyrosine-protein phosphatase non-receptor type 22 (PTN22), partial

This Recombinant Human Tyrosine-protein phosphatase non-receptor type 22 (PTN22), partial spans the amino acid sequence from region 24-289. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tyrosine-protein phosphatase non-receptor type 22; EC 3.1.3.48; Hematopoietic cell protein-tyrosine phosphatase 70Z-PEP; Lymphoid phosphatase; LyP; PEST-domain phosphatase; PEP; PTPN22 PTPN8

UniProt

Q9Y2R2

Expression Region

24-289

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FANEFLKLKRQSTKYKADKTYPTTVAEKPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYIATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCERYWAEPGEMQLEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPSSIDPILELIWDVRCYQEDDSVPICIHCSAGCGRTGVICAIDYTWMLLKDGIIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GC Antibody
CSB-PA944210-01 50 μL

GC Antibody

Sign In for Pricing
View Details
GC Antibody
CSB-PA944210-02 100 µL

GC Antibody

Sign In for Pricing
View Details
LINC00467 ORF Vector (Human) (pORF)
ORF022935 1.0 µg DNA

LINC00467 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IL-36RN Antibody
7511-002mg 0.02 mg

IL-36RN Antibody

Sign In for Pricing
View Details
Fiz1 3'UTR GFP Stable Cell Line
TU156591 1.0 mL

Fiz1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Hamster Smoothelin ELISA Kit
MBS086322-01 48 Well

Hamster Smoothelin ELISA Kit

Sign In for Pricing
View Details