Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human AP-3 complex subunit mu-1 (AP3M1)

This Recombinant Human AP-3 complex subunit mu-1 (AP3M1) spans the amino acid sequence from region 1-418. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AP-3 complex subunit mu-1; AP-3 adaptor complex mu3A subunit; Adaptor-related protein complex 3 subunit mu-1; Mu-adaptin 3A; Mu3A-adaptin; AP3M1

UniProt

Q9Y2T2

Expression Region

1-418

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIHSLFLINCSGDIFLEKHWKSVVSQSVCDYFFEAQEKAADVENVPPVISTPHHYLISIYRDKLFFVSVIQTEVPPLFVIEFLHRVADTFQDYFGECSEAAIKDNVVIVYELLEEMLDNGFPLATESNILKELIKPPTILRSVVNSITGSSNVGDTLPTGQLSNIPWRRAGVKYTNNEAYFDVVEEIDAIIDKSGSTVFAEIQGVIDACIKLSGMPDLSLSFMNPRLLDDVSFHPCIRFKRWESERVLSFIPPDGNFRLISYRVSSQNLVAIPVYVKHSISFKENSSCGRFDITIGPKQNMGKTIEGITVTVHMPKVVLNMNLTPTQGSYTFDPVTKVLTWDVGKITPQKLPSLKGLVNLQSGAPKPEENPSLNIQFKIQQLAISGLKVNRLDMYGEKYKPFKGVKYVTKAGKFQVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) CLIA Kit
E-CL-H0543-01 24 Tests

Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) CLIA Kit

Sign In for Pricing
View Details
Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) CLIA Kit
E-CL-H0543-02 48 Tests

Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) CLIA Kit

Sign In for Pricing
View Details
Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) CLIA Kit
E-CL-H0543-03 96 Tests

Human NOS3/eNOS (Nitric Oxide Synthase 3, Endothelial) CLIA Kit

Sign In for Pricing
View Details
Harmaline
M21712-01 1 g

Harmaline

Sign In for Pricing
View Details
Harmaline
M21712-02 100 mg

Harmaline

Sign In for Pricing
View Details
Harmaline
M21712-03 200 mg

Harmaline

Sign In for Pricing
View Details