Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2)

This Recombinant Human U6 snRNA-associated Sm-like protein LSm2 (LSM2) spans the amino acid sequence from region 1-95. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U6 snRNA-associated Sm-like protein LSm2; Protein G7b; Small nuclear ribonuclear protein D homolog; snRNP core Sm-like protein Sm-x5; LSM2 C6orf28 G7B

UniProt

Q9Y333

Expression Region

1-95

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT2 siRNA (Human)
orb1861082-01 15 nmol

AGPAT2 siRNA (Human)

Sign In for Pricing
View Details
AGPAT2 siRNA (Human)
orb1861082-02 30 nmol

AGPAT2 siRNA (Human)

Sign In for Pricing
View Details
RNF25 AAV Vector (Human) (CMV)
40303101 1 µg

RNF25 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Tmem20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
46983114 3x 1.0 µg

Tmem20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
CYP4F3 (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B (4) omega-hydroxylase 2, Leukotriene-B (4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) (AP) discontinued
125595-AP 100 µL

CYP4F3 (Cytochrome P450 4F3, CYPIVF3, Leukotriene-B (4) omega-hydroxylase 2, Leukotriene-B (4) 20-monooxygenase 2, Cytochrome P450-LTB-omega, LTB4H) (AP) discontinued

Sign In for Pricing
View Details
Recombinant Microcystis aeruginosa ATP synthase subunit c (atpE)
MBS1241477 Inquire

Recombinant Microcystis aeruginosa ATP synthase subunit c (atpE)

Sign In for Pricing
View Details