Recombinant Human Mitochondrial fission 1 protein (FIS1), partial
This Recombinant Human Mitochondrial fission 1 protein (FIS1), partial spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Mitochondrial fission 1 protein; FIS1 homolog; hFis1; Tetratricopeptide repeat protein 11; TPR repeat protein 11; FIS1 TTC11 CGI-135
UniProt
Q9Y3D6
Expression Region
1-122
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880181-500 1x 500 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741422-100 1x 100 µL
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (NX2/1422R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041532-100 1x 100 µL
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (CDH16/1532R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880172-500 1x 500 µL
CD45 / LCA (135-4C5), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details