Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Signaling threshold-regulating transmembrane adapter 1 (SIT1), partial

This Recombinant Human Signaling threshold-regulating transmembrane adapter 1 (SIT1), partial spans the amino acid sequence from region 62-196. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Signaling threshold-regulating transmembrane adapter 1; SHP2-interacting transmembrane adapter protein; Suppression-inducing transmembrane adapter 1; gp30/40; SIT1 SIT

UniProt

Q9Y3P8

Expression Region

62-196

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HLSQWTRGRSRSHPGQGRSGESVEEVPLYGNLHYLQTGRLSQDPEPDQQDPTLGGPARAAEEVMCYTSLQLRPPQGRIPGPGTPVKYSEVVLDSEPKSQASGPEPELYASVCAQTRRARASFPDQAYANSQPAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALPL Antibody
A21693-50UG 50 µg

ALPL Antibody

Sign In for Pricing
View Details
LOC100040121 (m) -PR
sc-147206-PR 10 µM - 20 µL

LOC100040121 (m) -PR

Sign In for Pricing
View Details
CDH15 Antibody, Biotin conjugated
CSB-PA005040LD01HU-01 50 µg

CDH15 Antibody, Biotin conjugated

Sign In for Pricing
View Details
CDH15 Antibody, Biotin conjugated
CSB-PA005040LD01HU-02 100 µg

CDH15 Antibody, Biotin conjugated

Sign In for Pricing
View Details
DSCR8 Recombinant Protein (Human)
RP009847 100 µg

DSCR8 Recombinant Protein (Human)

Sign In for Pricing
View Details
Conjugated Bcl10 Rabbit mAb
C59791 100 µL

Conjugated Bcl10 Rabbit mAb

Sign In for Pricing
View Details