Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5'-AMP-activated protein kinase subunit beta-1 (AAKB1)

This Recombinant Human 5'-AMP-activated protein kinase subunit beta-1 (AAKB1) spans the amino acid sequence from region 2-270. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5'-AMP-activated protein kinase subunit beta-1; AMPK subunit beta-1; AMPKb; PRKAB1 AMPK

UniProt

Q9Y478

Expression Region

2-270

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JTP10-?-R9 TFA
MBS5789539 Inquire

JTP10-?-R9 TFA

Sign In for Pricing
View Details
OKCD02119-96W - N6AMT1 ELISA Kit (Human)
OKCD02119-96W 96 Well

OKCD02119-96W - N6AMT1 ELISA Kit (Human)

Sign In for Pricing
View Details
BRCA1 antibody
MBS5309528-01 0.05 mg

BRCA1 antibody

Sign In for Pricing
View Details
BRCA1 antibody
MBS5309528-02 5x 0.05 mg

BRCA1 antibody

Sign In for Pricing
View Details
Human MAPK12 Protein, His & GST Tag
E40KMPH5196 20 µg

Human MAPK12 Protein, His & GST Tag

Sign In for Pricing
View Details
CP013 (N-term) Rabbit Polyclonal Antibody
E10G30893 100 µL

CP013 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details