Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable RNA-binding protein 19 (RBM19), partial

This Recombinant Human Probable RNA-binding protein 19 (RBM19), partial spans the amino acid sequence from region 730-811. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable RNA-binding protein 19; RNA-binding motif protein 19; RBM19 KIAA0682

UniProt

Q9Y4C8

Expression Region

730-811

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTLFIKNLNFDTTEEKLKEVFSKVGTVKSCSISKKKNKAGVLLSMGFGFVEYRKPEQAQKALKQLQGHVVDGHKLEVRISER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXOC7 (NM_001282314) Human Tagged ORF Clone
RG236166 10 µg

EXOC7 (NM_001282314) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-PLC-gamma-1 (Y783) Recombinant Rabbit Monoclonal Antibody [PSH06-29]
HA722661 100 µL

Phospho-PLC-gamma-1 (Y783) Recombinant Rabbit Monoclonal Antibody [PSH06-29]

Sign In for Pricing
View Details
INO80C (NM_001098817) Human Over-expression Lysate
LC420349 20 µg

INO80C (NM_001098817) Human Over-expression Lysate

Sign In for Pricing
View Details
c-Jun (JUN) Rabbit Polyclonal Antibody
AP06612PU-N 100 µg

c-Jun (JUN) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561780 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: femur
CS716940 5x 5 µm

Tissue FFPE Sections, Bone: femur

Sign In for Pricing
View Details