Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Unconventional myosin-Va (MYO5A), partial

This Recombinant Human Unconventional myosin-Va (MYO5A), partial spans the amino acid sequence from region 69-763. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Unconventional myosin-Va; Dilute myosin heavy chain, non-muscle; Myosin heavy chain 12; Myosin-12; Myoxin; MYO5A MYH12

UniProt

Q9Y4I1

Expression Region

69-763

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VGENDLTALSYLHEPAVLHNLRVRFIDSKLIYTYCGIVLVAINPYEQLPIYGEDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAKLPEFKMLRLGNADNFNYTKQGGSPVIEGVDDAKEMAHTRQACTLLGISESHQMGIFRILAGILHLGNVGFTSRDADSCTIPPKHEPLCIFCELMGVDYEEMCHWLCHRKLATATETYIKPISKLQATNARDALAKHIYAKLFNWIVDNVNQALHSAVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIESKLGILDLLDEECKMPKGTDDTWAQKLYNTHLNKCALFEKPRLSNKAFIIQHFADKVEYQCEGFLEKNKDTVFEEQIKVLKSSKFKMLPELFQDDEKAISPTSATSSGRTPLTRTPAKPTKGRPGQMAKEHKKTVGHQFRNSLHLLMETLNATTPHYVRCIKPNDFKFPFTFDEKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLSDRKQTCKNVLEKLILDKDKYQFGKTKIFFRAGQVAYLEKLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAMP1 Recombinant Monoclonal Antibody
RAA00552-01 100 µL

LAMP1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
LAMP1 Recombinant Monoclonal Antibody
RAA00552-02 200 µL

LAMP1 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
3-[ (3,4-difluorophenyl) thio]propanoic acid
sc-344781A 1 g

3-[ (3,4-difluorophenyl) thio]propanoic acid

Sign In for Pricing
View Details
Ethyl 5-amino-1-benzylpyrazole-4-carboxylate
275612-01 250 mg

Ethyl 5-amino-1-benzylpyrazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 5-amino-1-benzylpyrazole-4-carboxylate
275612-02 500 mg

Ethyl 5-amino-1-benzylpyrazole-4-carboxylate

Sign In for Pricing
View Details
Ethyl 5-amino-1-benzylpyrazole-4-carboxylate
275612-03 1 g

Ethyl 5-amino-1-benzylpyrazole-4-carboxylate

Sign In for Pricing
View Details