Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear protein AMMECR1 (AMMR1)

This Recombinant Human Nuclear protein AMMECR1 (AMMR1) spans the amino acid sequence from region 1-333. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear protein AMMECR1; AMME syndrome candidate gene 1 protein; AMMECR1

UniProt

Q9Y4X0

Expression Region

1-333

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAGCCGVKKQKLSSSPPSGSGGGGGASSSSHCSGESQCRAGELGLGGAGTRLNGLGGLTGGGSGSGCTLSPPQGCGGGGGGIALSPPPSCGVGTLLSTPAAATSSSPSSSSAASSSSPGSRKMVVSAEMCCFCFDVLYCHLYGYQQPRTPRFTNEPYPLFVTWKIGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRFPPMTRDELPRLFCSVSLLTNFEDVCDYLDWEVGVHGIRIEFINEKGSKRTATYLPEVAKEQGWDHIQTIDSLLRKGGYKAPITNEFRKTIKLTRYRSEKMTLSYAEYLAHRQHHHFQNGIGHPLPPYNHYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-DARS antibody
STJ28657 100 µl

Anti-DARS antibody

Sign In for Pricing
View Details
TEKT5 Rabbit Polyclonal Antibody
TA333511 100 µL

TEKT5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ICE2 Polyclonal Antibody
MBS8567659-01 0.1 mL

ICE2 Polyclonal Antibody

Sign In for Pricing
View Details
ICE2 Polyclonal Antibody
MBS8567659-02 0.1 mL (AF405L)

ICE2 Polyclonal Antibody

Sign In for Pricing
View Details
ICE2 Polyclonal Antibody
MBS8567659-03 0.1 mL (AF405S)

ICE2 Polyclonal Antibody

Sign In for Pricing
View Details
ICE2 Polyclonal Antibody
MBS8567659-04 0.1 mL (AF610)

ICE2 Polyclonal Antibody

Sign In for Pricing
View Details