Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human U6 snRNA-associated Sm-like protein LSm5 (LSM5)

This Recombinant Human U6 snRNA-associated Sm-like protein LSm5 (LSM5) spans the amino acid sequence from region 2-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

U6 snRNA-associated Sm-like protein LSm5 LSM5

UniProt

Q9Y4Y9

Expression Region

2-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA2 Double Nickase Plasmid (h)
sc-410804-NIC 20 µg

GSTA2 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Fish MANSC Domain Containing Protein 1 ELISA Kit
MBS061374 Inquire

Fish MANSC Domain Containing Protein 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Igf2r ELISA KIT
ELI-05330m 96 Tests

Mouse Igf2r ELISA KIT

Sign In for Pricing
View Details
Ipo4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
25030116 3x 1.0 µg

Ipo4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CRAC1 siRNA Oligos set (Human)
16799171 3x 5 nmol

CRAC1 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Recombinant Candida albicans Secreted aspartic protease 9 (SAP9)
CSB-YP522117CZF-01 20 µg

Recombinant Candida albicans Secreted aspartic protease 9 (SAP9)

Sign In for Pricing
View Details