Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-16 (CLD16), partial

This Recombinant Human Claudin-16 (CLD16), partial spans the amino acid sequence from region 25-79. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-16; Paracellin-1; PCLN-1; CLDN16 PCLN1

UniProt

Q9Y5I7

Expression Region

25-79

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

WTDCWMVNADDSLEVSTKCRGLWWECVTNAFDGIRTCDEYDSILAEHPLKLVVTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SH3GL3 AssayLite™ Antibody (PerCP Conjugate)
35637-05171 5x 30 µg

Human SH3GL3 AssayLite™ Antibody (PerCP Conjugate)

Sign In for Pricing
View Details
USH2A CRISPR All-in-one AAV vector set (with saCas9)(Rat)
49265156 3x 1.0 µg DNA

USH2A CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
ANXA10 Rabbit pAb, PE-Cy5 conjugated
orb3183889 100 µL

ANXA10 Rabbit pAb, PE-Cy5 conjugated

Sign In for Pricing
View Details
Anti-PRPF6 antibody
STJ119358 100 µl

Anti-PRPF6 antibody

Sign In for Pricing
View Details
RGD1560455 Rat shRNA Plasmid (Locus ID 302377)
TR705512 1 Kit

RGD1560455 Rat shRNA Plasmid (Locus ID 302377)

Sign In for Pricing
View Details
USP36 Rabbit pAb
E45R19712N-100 100 µL

USP36 Rabbit pAb

Sign In for Pricing
View Details