Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial

This Recombinant Human Mitochondrial pyruvate carrier 1 (MPC1), partial spans the amino acid sequence from region 72-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1; Brain protein 44-like protein; MPC1 BRP44L CGI-129 HSPC040 PNAS-115

UniProt

Q9Y5U8

Expression Region

72-109

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf141 (NM_080739) Human Recombinant Protein
TP305215M 100 µg

C20orf141 (NM_080739) Human Recombinant Protein

Sign In for Pricing
View Details
Pregnancy Specific Glycoprotein 1 (PSG1) (NM_006905) Human Over-expression Lysate
LY402056 100 µg

Pregnancy Specific Glycoprotein 1 (PSG1) (NM_006905) Human Over-expression Lysate

Sign In for Pricing
View Details
ELOC (C-term) Rabbit Polyclonal Antibody
AP54199PU-N 400 µL

ELOC (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: left
CS709015 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS507761 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF405S conjugate, 0.1mg/mL
BNC043635-100 1x 100 µL

Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details