Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial

This Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial spans the amino acid sequence from region 23-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1 IER3IP1 HSPC039

UniProt

Q9Y5U9

Expression Region

23-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein E (APOE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B9]
TA805358BM 100 µL

Apolipoprotein E (APOE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3B9]

Sign In for Pricing
View Details
2-Ethynylpyridine
TRC-E937503-250MG 250 mg

2-Ethynylpyridine

Sign In for Pricing
View Details
CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), Biotin conjugate, 0.1mg/mL
BNCB2884-100 1x 100 µL

CD6 (Negative Marker of T-regulatory Cells) (C6/2884R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CDA (NM_001785) Human Over-expression Lysate
LC419748 20 µg

CDA (NM_001785) Human Over-expression Lysate

Sign In for Pricing
View Details
Diphenhydramine-d5 Hydrochloride (Phenyl-d5)
TRC-D486901-2MG 2 mg

Diphenhydramine-d5 Hydrochloride (Phenyl-d5)

Sign In for Pricing
View Details
Cd163 Mouse Gene Knockout Kit (CRISPR)
KN502864 1 Kit

Cd163 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details