Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial

This Recombinant Human Immediate early response 3-interacting protein 1 (IR3IP), partial spans the amino acid sequence from region 23-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1 IER3IP1 HSPC039

UniProt

Q9Y5U9

Expression Region

23-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF640R conjugate, 0.1mg/mL
BNC403291-500 1x 500 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC11 Human Gene Knockout Kit (CRISPR)
KN201919RB 1 Kit

HDAC11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IL-7 Protein, Fc Tag (MALS verified)
IL7-H5253-50ug 50 µg

Human IL-7 Protein, Fc Tag (MALS verified)

Sign In for Pricing
View Details
Sex Hormone Binding GlobuLin (SHBG) (NM_001146281) Human Over-expression Lysate
LC431248 20 µg

Sex Hormone Binding GlobuLin (SHBG) (NM_001146281) Human Over-expression Lysate

Sign In for Pricing
View Details
PGS1 (NM_024419) Human Over-expression Lysate
LY402987 100 µg

PGS1 (NM_024419) Human Over-expression Lysate

Sign In for Pricing
View Details
SM22 alpha (TAGLN) (NM_003186) Human Over-expression Lysate
LC401104 20 µg

SM22 alpha (TAGLN) (NM_003186) Human Over-expression Lysate

Sign In for Pricing
View Details