Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sorting nexin-14 (SNX14), partial

This Recombinant Human Sorting nexin-14 (SNX14), partial spans the amino acid sequence from region 130-304. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sorting nexin-14 SNX14

UniProt

Q9Y5W7

Expression Region

130-304

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SSKVDASLSEVLELVLENFVYPWYRDVTDDESFVDELRITLRFFASVLIRRIHKVDIPSIITKKLLKAAMKHIEVIVKARQKVKNTEFLQQAALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFIDDSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parathyroid hormone related protein (PTHLH) (107-111) Rabbit Polyclonal Antibody
AP02157SU-S 20 µL

Parathyroid hormone related protein (PTHLH) (107-111) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bisphenol B
TRC-B519565-25G 25 g

Bisphenol B

Sign In for Pricing
View Details
ACP1 Antibody (Biotin)
KB-8135-01 50 μL

ACP1 Antibody (Biotin)

Sign In for Pricing
View Details
ACP1 Antibody (Biotin)
KB-8135-02 100 µL

ACP1 Antibody (Biotin)

Sign In for Pricing
View Details
ACP1 Antibody (Biotin)
KB-8135-03 1 mL

ACP1 Antibody (Biotin)

Sign In for Pricing
View Details
Human ABCG8 activation kit by CRISPRa
GA112028 1 Kit

Human ABCG8 activation kit by CRISPRa

Sign In for Pricing
View Details