Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial

This Recombinant Human UbiA prenyltransferase domain-containing protein 1 (UBIA1), partial spans the amino acid sequence from region 2-82. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UbiA prenyltransferase domain-containing protein 1; EC 2.5.1.-; EC 2.5.1.39; Transitional epithelial response protein 1; UBIAD1 TERE1

UniProt

Q9Y5Z9

Expression Region

2-82

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVLDPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RANK Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb1579633 100 µL

RANK Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
N4bp3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4632807 1.0 µg DNA

N4bp3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit
MBS7208904-01 48 Well

Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit

Sign In for Pricing
View Details
Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit
MBS7208904-02 96 Well

Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit

Sign In for Pricing
View Details
Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit
MBS7208904-03 5x 96 Well

Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit

Sign In for Pricing
View Details
Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit
MBS7208904-04 10x 96 Well

Goat ADP-ribosylation factor-like protein 4C (ARL4C) ELISA Kit

Sign In for Pricing
View Details