Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Solute carrier family 12 member 7 (S12A7), partial

This Recombinant Human Solute carrier family 12 member 7 (S12A7), partial spans the amino acid sequence from region 301-419. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Solute carrier family 12 member 7; Electroneutral potassium-chloride cotransporter 4; K-Cl cotransporter 4; SLC12A7 KCC4

UniProt

Q9Y666

Expression Region

301-419

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSAACDEYFIQNNVTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal AK3 Antibody (SJB3-36) [FITC]
NBP1-04261F 0.1 mL

Mouse Monoclonal AK3 Antibody (SJB3-36) [FITC]

Sign In for Pricing
View Details
BZW1 Protein Vector (Mouse) (pPM-C-HA)
13593024 500 ng

BZW1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
C16orf7 Polyclonal Antibody
bs-9629R 100 µL

C16orf7 Polyclonal Antibody

Sign In for Pricing
View Details
GATS (AK056608) Human Untagged Clone
SC101467 10 µg

GATS (AK056608) Human Untagged Clone

Sign In for Pricing
View Details
DPY19L1 Antibody
GWB-MP516C 50 µg

DPY19L1 Antibody

Sign In for Pricing
View Details
Pnrc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K7160506 1.0 µg DNA

Pnrc1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details