Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial

This Recombinant Human Proton-coupled zinc antiporter SLC30A1 (ZNT1), partial spans the amino acid sequence from region 270-308. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Proton-coupled zinc antiporter SLC30A1; Solute carrier family 30 member 1; Zinc transporter 1; SLC30A1 ZNT1

UniProt

Q9Y6M5

Expression Region

270-308

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YFSWKGCSEGDFCVNPCFPDPCKAFVEIINSTHASVYEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse METAP1 siRNA
abx923953-01 15 nmol

Mouse METAP1 siRNA

Sign In for Pricing
View Details
Mouse METAP1 siRNA
abx923953-02 30 nmol

Mouse METAP1 siRNA

Sign In for Pricing
View Details
ALDOA 3'UTR Lenti-reporter-Luc Vector
11747081 1.0 µg

ALDOA 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TLL1 Protein Vector (Rat) (pPB-N-His)
PV310995 500 ng

TLL1 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
CBWD6 Human shRNA Plasmid Kit (Locus ID 644019)
TL320971 1 Kit

CBWD6 Human shRNA Plasmid Kit (Locus ID 644019)

Sign In for Pricing
View Details
Pik3cd Mouse siRNA Oligo Duplex (Locus ID 18707)
SR421859 1 Kit

Pik3cd Mouse siRNA Oligo Duplex (Locus ID 18707)

Sign In for Pricing
View Details