Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sulfide:quinone oxidoreductase, mitochondrial (SQOR), partial

This Recombinant Human Sulfide:quinone oxidoreductase, mitochondrial (SQOR), partial spans the amino acid sequence from region 42-450. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sulfide:quinone oxidoreductase, mitochondrial; SQOR; EC 1.8.5.8; Sulfide dehydrogenase-like; Sulfide quinone oxidoreductase; SQOR SQRDL CGI-44

UniProt

Q9Y6N5

Expression Region

42-450

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

NHYEVLVLGGGSGGITMAARMKRKVGAENVAIVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSPPDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

THPO (MGC163194, MGDF, MKCSF, ML, MPLLG, TPO, MPL ligand, c-mpl ligand, Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, Megakaryocyte stimulating factor, Myeloproliferative leukemia virus oncogene ligand, Thrombopoietin nirs variant 1)
588774 50 µg

THPO (MGC163194, MGDF, MKCSF, ML, MPLLG, TPO, MPL ligand, c-mpl ligand, Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, Megakaryocyte stimulating factor, Myeloproliferative leukemia virus oncogene ligand, Thrombopoietin nirs variant 1)

Sign In for Pricing
View Details
LRIG2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
27596064 1.0 µg DNA

LRIG2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rabbit Polyclonal ARHGAP11A Antibody [HRP]
NBP2-99558H 0.1 mL

Rabbit Polyclonal ARHGAP11A Antibody [HRP]

Sign In for Pricing
View Details
Rat Chchd6 Pre-designed siRNA Set B
SI202669B 1 Each

Rat Chchd6 Pre-designed siRNA Set B

Sign In for Pricing
View Details
C2CD6 Antibody
orb519912-01 50 μL

C2CD6 Antibody

Sign In for Pricing
View Details
C2CD6 Antibody
orb519912-02 100 µL

C2CD6 Antibody

Sign In for Pricing
View Details