Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein myomixer (MYMX), partial

This Recombinant Human Protein myomixer (MYMX), partial spans the amino acid sequence from region 26-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein myomixer; Microprotein inducer of fusion; Protein minion; hMINION; MYMX

UniProt

A0A1B0GTQ4

Expression Region

26-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RQYLLPLLRRLARRLGSQDMREALLGCLLFILSQRHSPDAGEASRVDRLERRERLGPQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GP2 Peptide
orb2016043 100 µg

GP2 Peptide

Sign In for Pricing
View Details
TNFSF13 Antibody Blocking peptide
orb1447307 500 µg

TNFSF13 Antibody Blocking peptide

Sign In for Pricing
View Details
SPAG1, NT (SPAG1, Sperm-associated antigen 1, HSD-3.8, Infertility-related sperm protein Spag-1) (MaxLight 550) discontinued
042194-ML550 100 µL

SPAG1, NT (SPAG1, Sperm-associated antigen 1, HSD-3.8, Infertility-related sperm protein Spag-1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
DRAK2 (STK17B) Human shRNA Plasmid Kit (Locus ID 9262)
TL309047 1 Kit

DRAK2 (STK17B) Human shRNA Plasmid Kit (Locus ID 9262)

Sign In for Pricing
View Details
Lentiviral mouse Usp34 shRNA (UAS) - Lentiviral mouse Usp34 shRNA (UAS, RFP) (25)
GTR15291683 1 Vial

Lentiviral mouse Usp34 shRNA (UAS) - Lentiviral mouse Usp34 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rd3l AAV Vector (Mouse) (CMV)
38761104 1 µg

Rd3l AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details