Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small regulatory polypeptide of amino acid response (SPAR), partial

This Recombinant Human Small regulatory polypeptide of amino acid response (SPAR), partial spans the amino acid sequence from region 40-90. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small regulatory polypeptide of amino acid response SPAAR LINC00961 SPAR

UniProt

A0A1B0GVQ0

Expression Region

40-90

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CFSCDSRAQDPQGGPGRSFTVATFRQEASLFTGPVRHAQPVPSAQDFWTFM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC anti-mouse CD129 (IL-9R)
GT05978 100 µg

APC anti-mouse CD129 (IL-9R)

Sign In for Pricing
View Details
Phospho-MSK1 (Ser376) Polyclonal Antibody, PE Conjugated
bs-3283R-PE-TR 20 µL

Phospho-MSK1 (Ser376) Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
Recombinant Escherichia coli lys Protein (aa 18-45)
VAng-Lsx02477-500gEcoli 500 µg (E. coli)

Recombinant Escherichia coli lys Protein (aa 18-45)

Sign In for Pricing
View Details
SNORD114-29 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K2241106 1.0 µg DNA

SNORD114-29 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Mouse Pdgfd qPCR Primer Pair
QM40154S 200 Tests

Mouse Pdgfd qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit anti-Human HIST1H2AG Polyclonal Antibody
MBS7137269-01 0.05 mL

Rabbit anti-Human HIST1H2AG Polyclonal Antibody

Sign In for Pricing
View Details