Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2-29 (KV229)

This Recombinant Human Immunoglobulin kappa variable 2-29 (KV229) spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2-29 IGKV2-29

UniProt

A2NJV5

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIVMTQTPLSLSVTPGQPASISCKSSQSLLHSDGKTYLYWYLQKPGQSPQLLIYEVSSRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCMQGIHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Islet amyloid Polypeptide, IAPP GENLISA ELISA
KLP0331 96 Well

Porcine Islet amyloid Polypeptide, IAPP GENLISA ELISA

Sign In for Pricing
View Details
Human Apoprotein J (APO-J) ELISA Kit
MBS3801701-01 48 Well

Human Apoprotein J (APO-J) ELISA Kit

Sign In for Pricing
View Details
Human Apoprotein J (APO-J) ELISA Kit
MBS3801701-02 96 Well

Human Apoprotein J (APO-J) ELISA Kit

Sign In for Pricing
View Details
Human Apoprotein J (APO-J) ELISA Kit
MBS3801701-03 5x 96 Well

Human Apoprotein J (APO-J) ELISA Kit

Sign In for Pricing
View Details
Human Apoprotein J (APO-J) ELISA Kit
MBS3801701-04 10x 96 Well

Human Apoprotein J (APO-J) ELISA Kit

Sign In for Pricing
View Details
Trichloro (isopropyl) stannane
JH236704 1 Each

Trichloro (isopropyl) stannane

Sign In for Pricing
View Details