Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PTEN upstream open reading frame MP31 (MP31)

This Recombinant Human PTEN upstream open reading frame MP31 (MP31) spans the amino acid sequence from region 1-31. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PTEN upstream open reading frame MP31; Micropeptide 31; Mitochondrial lactate dehydrogenase regulator; MLDHR MP31

UniProt

C0HLV8

Expression Region

1-31

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MWRDSLCAAAGYALGAGTRLRSVLSSRKLQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P16INK4A Antibody
orb1316927 100 µL

P16INK4A Antibody

Sign In for Pricing
View Details
ACSL6 Rabbit Polyclonal Antibody
E28PT0092 100 µL

ACSL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Oas1b (NM_001083925) Mouse Tagged Lenti ORF Clone
MR220810L3 10 µg

Oas1b (NM_001083925) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pdlim4 ORF Vector (Mouse) (pORF)
ORF053705 1.0 µg DNA

Pdlim4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Bsg ELISA Kit (Rat)
OKEH04725-96W 96 Well

Bsg ELISA Kit (Rat)

Sign In for Pricing
View Details
TBXA2R Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV693155 1.0 µg DNA

TBXA2R Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details