Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial

This Recombinant Human Nascent polypeptide-associated complex subunit alpha, muscle-specific form (NACAM), partial spans the amino acid sequence from region 1933-1998. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nascent polypeptide-associated complex subunit alpha, muscle-specific form; Alpha-NAC, muscle-specific form; skNAC; NACA

UniProt

E9PAV3

Expression Region

1933-1998

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRSEKKARKAMSKLGLRQVTGVTRVTIRKSKNILFVITKPDVYKSPASDTYIVFGEAKIEDLSQQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-6-Oxo-pipecolinic acid
sc-268833 100 mg

D-6-Oxo-pipecolinic acid

Sign In for Pricing
View Details
Human Angiomotin (AMOT) CLIA Kit
abx493594-01 96 Tests

Human Angiomotin (AMOT) CLIA Kit

Sign In for Pricing
View Details
Human Angiomotin (AMOT) CLIA Kit
abx493594-02 5x 96 Tests

Human Angiomotin (AMOT) CLIA Kit

Sign In for Pricing
View Details
Human Angiomotin (AMOT) CLIA Kit
abx493594-03 10x 96 Tests

Human Angiomotin (AMOT) CLIA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Lysozyme Antibody (LYZ/3942) [FITC]
NBP3-14114F 0.1 mL

Mouse Monoclonal Lysozyme Antibody (LYZ/3942) [FITC]

Sign In for Pricing
View Details
RPS18P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV783732 1.0 µg DNA

RPS18P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details