Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Piercer of microtubule wall 2 protein (PIRC2)

This Recombinant Human Piercer of microtubule wall 2 protein (PIRC2) spans the amino acid sequence from region 1-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Piercer of microtubule wall 2 protein PIERCE2 C15orf65

UniProt

H3BRN8

Expression Region

1-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTDRNRDKKSTSPSNSDTEMKSEQLPPCVNPGNPVFSCMLDPKTLQTATSLSKPQMIMYKTNSSHYGEFLPIPQFFPCNYTPKEQVFSSHIRATGFYQNNTLNTAPDRTRTLDFPNIQHTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2�-MOE-G 2 umol scale
27-6450G-03 1 Each

2�-MOE-G 2 umol scale

Sign In for Pricing
View Details
4α,25-Dihydroxy Cholesterol
009947 1 mg

4α,25-Dihydroxy Cholesterol

Sign In for Pricing
View Details
SLC37A2 Human shRNA Plasmid Kit (Locus ID 219855)
TR301580 1 Kit

SLC37A2 Human shRNA Plasmid Kit (Locus ID 219855)

Sign In for Pricing
View Details
Lentiviral human SNTA1 shRNA (UAS) - Lentiviral human SNTA1 shRNA (UAS, iRFP) (25)
GTR15121886 1 Vial

Lentiviral human SNTA1 shRNA (UAS) - Lentiviral human SNTA1 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral human BLCAP sgRNA gene knockout kit - Lentiviral human BLCAP sgRNA gene knockout kit (25)
GTR15392547 1 Vial

Lentiviral human BLCAP sgRNA gene knockout kit - Lentiviral human BLCAP sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rasl12 (NM_001162923) Mouse Tagged Lenti ORF Clone
MR219049L4 10 µg

Rasl12 (NM_001162923) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details