Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Suppressyn (SUPYN)

This Recombinant Human Suppressyn (SUPYN) spans the amino acid sequence from region 40-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Suppressyn; Endogenous retrovirus group 48 member 1; NDUFV3 antisense RNA 1; endogenous retrovirus group Fb member 1; ERVH48-1 C21orf105 HERV-Fb1 NDUFV3-AS1

UniProt

M5A8F1

Expression Region

40-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APPSCRECYQSLHYRGEMQQYFTYHTHIERSCYGNLIEECVESGKSYYKVKNLGVCGSRNGAICPRGKQWLCFTKIGQWGVNTQVLEDIKREQIIAKAKASKPTTPPENRPRHFHSFIQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG2 Human Gene Knockout Kit (CRISPR)
KN205640BN 1 Kit

ABCG2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLHDC2 (NM_014315) Human Over-expression Lysate
LC402313 20 µg

KLHDC2 (NM_014315) Human Over-expression Lysate

Sign In for Pricing
View Details
H-Val-Gln-OH
TRC-V191745-10MG 10 mg

H-Val-Gln-OH

Sign In for Pricing
View Details
B4GALNT4 Mouse Monoclonal Antibody [Clone ID: OTI9H2]
CF816145 100 µg

B4GALNT4 Mouse Monoclonal Antibody [Clone ID: OTI9H2]

Sign In for Pricing
View Details
Human VCAM-1 Recombinant Rabbit monoclonal Antibody
HA725066B 100 µL

Human VCAM-1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
BMP6 Mouse Monoclonal Antibody [Clone ID: OTI4A3]
CF812214 100 µg

BMP6 Mouse Monoclonal Antibody [Clone ID: OTI4A3]

Sign In for Pricing
View Details