Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Suppressyn (SUPYN)

This Recombinant Human Suppressyn (SUPYN) spans the amino acid sequence from region 40-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Suppressyn; Endogenous retrovirus group 48 member 1; NDUFV3 antisense RNA 1; endogenous retrovirus group Fb member 1; ERVH48-1 C21orf105 HERV-Fb1 NDUFV3-AS1

UniProt

M5A8F1

Expression Region

40-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

APPSCRECYQSLHYRGEMQQYFTYHTHIERSCYGNLIEECVESGKSYYKVKNLGVCGSRNGAICPRGKQWLCFTKIGQWGVNTQVLEDIKREQIIAKAKASKPTTPPENRPRHFHSFIQKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inosine triphosphate pyrophosphatase (ITPA) (NM_033453) Human Recombinant Protein
TP720525 10 µg

Inosine triphosphate pyrophosphatase (ITPA) (NM_033453) Human Recombinant Protein

Sign In for Pricing
View Details
Human KRTAP10-4 activation kit by CRISPRa
GA117858 1 Kit

Human KRTAP10-4 activation kit by CRISPRa

Sign In for Pricing
View Details
Bismuth(III) Chloride
TRC-B497368-250MG 250 mg

Bismuth(III) Chloride

Sign In for Pricing
View Details
VSIG4 Antibody
OC-269-01 50 μL

VSIG4 Antibody

Sign In for Pricing
View Details
VSIG4 Antibody
OC-269-02 100 µL

VSIG4 Antibody

Sign In for Pricing
View Details
VSIG4 Antibody
OC-269-03 1 mL

VSIG4 Antibody

Sign In for Pricing
View Details