Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 2 (OPSG2), partial

This Recombinant Human Medium-wave-sensitive opsin 2 (OPSG2), partial spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 2; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; Opsin 1 cone pigments medium-wave-sensitive 2; OPN1MW2

UniProt

P0DN77

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Scavenger Receptor B2/SR-B2/LIMPII/CD36L2 (N-6His)
32-8777-10 10 µg

Recombinant Mouse Scavenger Receptor B2/SR-B2/LIMPII/CD36L2 (N-6His)

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae uppP Protein (aa 1-282) (strain Br4923)
VAng-Yyj2453-10g 10 µg

Recombinant Mycobacterium Leprae uppP Protein (aa 1-282) (strain Br4923)

Sign In for Pricing
View Details
Guinea Pig Runt Related Transcription Factor 2 ELISA kit
GTR10425673 96 Well

Guinea Pig Runt Related Transcription Factor 2 ELISA kit

Sign In for Pricing
View Details
Goose Fibroblast Surface Protein ELISA Kit
MBS031722 Inquire

Goose Fibroblast Surface Protein ELISA Kit

Sign In for Pricing
View Details
Recombinant Salmonella newport UvrABC system protein B (uvrB), partial
MBS1102201 Inquire

Recombinant Salmonella newport UvrABC system protein B (uvrB), partial

Sign In for Pricing
View Details
CYP24A1 Rabbit Polyclonal Antibody (PE-Cy5.5)
orb900305 100 µL

CYP24A1 Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details