Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial

This Recombinant Human Medium-wave-sensitive opsin 3 (OPSG3), partial spans the amino acid sequence from region 1-52. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 3; Green cone photoreceptor pigment; Green-sensitive opsin; GOP; opsin 1 cone pigments medium-wave-sensitive 3; OPN1MW3

UniProt

P0DN78

Expression Region

1-52

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAQQWSLQRLAGRHPQDSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRWV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit
MBS7226086-01 48 Well

Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit

Sign In for Pricing
View Details
Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit
MBS7226086-02 96 Well

Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit

Sign In for Pricing
View Details
Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit
MBS7226086-03 5x 96 Well

Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit

Sign In for Pricing
View Details
Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit
MBS7226086-04 10x 96 Well

Guinea pig anti lupus anticoagulant antibody (IgG) ELISA Kit

Sign In for Pricing
View Details
Recombinant E. coli LPS-assembly lipoprotein lptE (lptE)
RPC29638-01 20 µg

Recombinant E. coli LPS-assembly lipoprotein lptE (lptE)

Sign In for Pricing
View Details
Recombinant E. coli LPS-assembly lipoprotein lptE (lptE)
RPC29638-02 100 µg

Recombinant E. coli LPS-assembly lipoprotein lptE (lptE)

Sign In for Pricing
View Details