Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin gamma-1 heavy chain (IGG1)

This Recombinant Human Immunoglobulin gamma-1 heavy chain (IGG1) spans the amino acid sequence from region 1-449. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin gamma-1 heavy chain; Immunoglobulin gamma-1 heavy chain NIE

UniProt

P0DOX5

Expression Region

1-449

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGGGVVQPGRSLRLSCAASGFTFSRYTIHWVRQAPGKGLEWVAVMSYNGNNKHYADSVNGRFTISRNDSKNTLYLNMNSLRPEDTAVYYCARIRDTAMFFAHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdh20 3'UTR Lenti-reporter-Luc Vector
36111084 1.0 µg

Pcdh20 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Dolphin IL-13 Polyclonal Antibody - Biotinylated
KPB1293P 50 µg

Dolphin IL-13 Polyclonal Antibody - Biotinylated

Sign In for Pricing
View Details
ACP5 Mouse Monoclonal Antibody
AMM81254-01 1 Each

ACP5 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ACP5 Mouse Monoclonal Antibody
AMM81254-02 50 µL

ACP5 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
ACP5 Mouse Monoclonal Antibody
AMM81254-03 100 µL

ACP5 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Human Abeta (aa 1-10), HRPO (clone: 5E5) (Mouse IgG)
MBS520696 0.1 mg

Anti-Human Abeta (aa 1-10), HRPO (clone: 5E5) (Mouse IgG)

Sign In for Pricing
View Details