Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein 45 (ZNF45)

This Recombinant Human Zinc finger protein 45 (ZNF45) spans the amino acid sequence from region 1-682. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein 45; BRC1744; Zinc finger protein 13; Zinc finger protein KOX5; ZNF45 KOX5 ZNF13

UniProt

Q02386

Expression Region

1-682

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTKSKEAVTFKDVAVVFSEEELQLLDLAQRKLYRDVMLENFRNVVSVGHQSTPDGLPQLEREEKLWMMKMATQRDNSSGAKNLKEMETLQEVGLRYLPHEELFCSQIWQQITRELIKYQDSVVNIQRTGCQLEKRDDLHYKDEGFSNQSSHLQVHRVHTGEKPYKGEHCVKSFSWSSHLQINQRAHAGEKPYKCEKCDNAFRRFSSLQAHQRVHSRAKSYTNDASYRSFSQRSHLPHHQRVPTGENPYKYEECGRNVGKSSHCQAPLIVHTGEKPYKCEECGVGFSQRSYLQVHLKVHTGKKPYKCEECGKSFSWRSRLQAHERIHTGEKPYKCNACGKSFSYSSHLNIHCRIHTGEKPYKCEECGKGFSVGSHLQAHQISHTGEKPYKCEECGKGFCRASNLLDHQRGHTGEKPYQCDACGKGFSRSSDFNIHFRVHTGEKPYKCEECGKGFSQASNLLAHQRGHTGEKPYKCGTCGKGFSRSSDLNVHCRIHTGEKPYKCERCGKAFSQFSSLQVHQRVHTGEKPYQCAECGKGFSVGSQLQAHQRCHTGEKPYQCEECGKGFCRASNFLAHRGVHTGEKPYRCDVCGKRFRQRSYLQAHQRVHTGERPYKCEECGKVFSWSSYLQAHQRVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDFPSSEDSHRKTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lif (NM_022196) Rat Tagged ORF Clone Lentiviral Particle
RR205959L3V 200 µL

Lif (NM_022196) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
2-Naphthyl β-D-glucopyranoside monohydrate
N6190-01 1 g

2-Naphthyl β-D-glucopyranoside monohydrate

Sign In for Pricing
View Details
2-Naphthyl β-D-glucopyranoside monohydrate
N6190-02 5 g

2-Naphthyl β-D-glucopyranoside monohydrate

Sign In for Pricing
View Details
Lentiviral human RCBTB2 shRNA (UAS) - Lentiviral human RCBTB2 shRNA (UAS, RFP) (25)
GTR15088583 1 Vial

Lentiviral human RCBTB2 shRNA (UAS) - Lentiviral human RCBTB2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
DCDC2 siRNA (Human)
CRH9781-01 15 nmol

DCDC2 siRNA (Human)

Sign In for Pricing
View Details
DCDC2 siRNA (Human)
CRH9781-02 30 nmol

DCDC2 siRNA (Human)

Sign In for Pricing
View Details