Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial

This Recombinant Human Centrosomal protein of 170 kDa protein B (C170B), partial spans the amino acid sequence from region 23-73. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Centrosomal protein of 170 kDa protein B; Centrosomal protein 170B; Cep170B; CEP170B FAM68C KIAA0284

UniProt

Q9Y4F5

Expression Region

23-73

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

IFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDMRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit
MBS102186 Inquire

Cavy Transient Receptor Potential Cation Channel Subfamily M, Member 4 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Srsf12 shRNA (UAS) - Lentiviral mouse Srsf12 shRNA (UAS, GFP) (100)
GTR15251061 1 Vial

Lentiviral mouse Srsf12 shRNA (UAS) - Lentiviral mouse Srsf12 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
EFCAB8 sgRNA CRISPR Lentivector (Human) (Target 2)
K0659103 1.0 µg DNA

EFCAB8 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Mammaglobin A Rabbit Polyclonal Antibody
orb6354-01 50 μL

Mammaglobin A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mammaglobin A Rabbit Polyclonal Antibody
orb6354-02 100 µL

Mammaglobin A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mammaglobin A Rabbit Polyclonal Antibody
orb6354-03 200 µL

Mammaglobin A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details