Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tesmin (MTL5)

This Recombinant Human Tesmin (MTL5) spans the amino acid sequence from region 1-508. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tesmin; Metallothionein-like 5, testis-specific; Testis-specific metallothionein-like protein; TESMIN MTL5

UniProt

Q9Y4I5

Expression Region

1-508

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAFQPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gna14 activation kit by CRISPRa
GA201647 1 Kit

Mouse Gna14 activation kit by CRISPRa

Sign In for Pricing
View Details
PKD1/PKC µ (Ab-910) Antibody
8B0721-AAT 50 µg

PKD1/PKC µ (Ab-910) Antibody

Sign In for Pricing
View Details
LINGO4 (NM_001004432) Human Recombinant Protein
TP315621 20 µg

LINGO4 (NM_001004432) Human Recombinant Protein

Sign In for Pricing
View Details
Kbtbd6 Mouse Gene Knockout Kit (CRISPR)
KN519630 1 Kit

Kbtbd6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anamorelin
TRC-A656510-5MG 5 mg

Anamorelin

Sign In for Pricing
View Details
Human CHSY3 activation kit by CRISPRa
GA117338 1 Kit

Human CHSY3 activation kit by CRISPRa

Sign In for Pricing
View Details