Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tesmin (MTL5)

This Recombinant Human Tesmin (MTL5) spans the amino acid sequence from region 1-508. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tesmin; Metallothionein-like 5, testis-specific; Testis-specific metallothionein-like protein; TESMIN MTL5

UniProt

Q9Y4I5

Expression Region

1-508

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAFQPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mono(2-ethyl-5-hexenyl) Phthalate
TRC-M542495-50MG 50 mg

Mono(2-ethyl-5-hexenyl) Phthalate

Sign In for Pricing
View Details
Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)
PKSH032452-01 10 µg

Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)
PKSH032452-02 50 µg

Recombinant Human FLT3LG/Flt3 Ligand Protein (His Tag)

Sign In for Pricing
View Details
Cathepsin D Mouse Monoclonal Antibody [13F3]
EM1901-16 100 µL

Cathepsin D Mouse Monoclonal Antibody [13F3]

Sign In for Pricing
View Details
Double Stranded DNA (dsDNA) (DSD/958), Biotin conjugate, 0.1mg/mL
BNCB0958-100 1x 100 µL

Double Stranded DNA (dsDNA) (DSD/958), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isotonitazene
TRC-I141880-250MG 250 mg

Isotonitazene

Sign In for Pricing
View Details