Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tesmin (MTL5)

This Recombinant Human Tesmin (MTL5) spans the amino acid sequence from region 1-508. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tesmin; Metallothionein-like 5, testis-specific; Testis-specific metallothionein-like protein; TESMIN MTL5

UniProt

Q9Y4I5

Expression Region

1-508

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPLGAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPMVICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGALPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAFQPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQTGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGRCLSQILHTEFKSKGLKME

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMEM238 activation kit by CRISPRa
GA117971 1 Kit

Human TMEM238 activation kit by CRISPRa

Sign In for Pricing
View Details
A23187
SIH-227-50MG 50 mg

A23187

Sign In for Pricing
View Details
Mini Sample Mouse LEP (Leptin) ELISA Kit
E-MSEL-M0033-01 24 Tests

Mini Sample Mouse LEP (Leptin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse LEP (Leptin) ELISA Kit
E-MSEL-M0033-02 48 Tests

Mini Sample Mouse LEP (Leptin) ELISA Kit

Sign In for Pricing
View Details
Mini Sample Mouse LEP (Leptin) ELISA Kit
E-MSEL-M0033-03 96 Tests

Mini Sample Mouse LEP (Leptin) ELISA Kit

Sign In for Pricing
View Details
SHP2 (PTPN11) (C-term) Rabbit Polyclonal Antibody
AP17690PU-N 400 µL

SHP2 (PTPN11) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details