Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1A2 (OR1A2), partial

This Recombinant Human Olfactory receptor 1A2 (OR1A2), partial spans the amino acid sequence from region 159-195. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 1A2; Olfactory receptor 17-6; OR17-6; Olfactory receptor OR17-10; OR1A2

UniProt

Q9Y585

Expression Region

159-195

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAMK2A pThr286 Rabbit Polyclonal Antibody
AP20879PU-N 100 µg

CAMK2A pThr286 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bromo Polystyrene
H40045009.25G 25 g

Bromo Polystyrene

Sign In for Pricing
View Details
Rusc1 Mouse Gene Knockout Kit (CRISPR)
KN515212 1 Kit

Rusc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2836), CF647 conjugate, 0.1mg/mL
BNC472836-100 1x 100 µL

NKX3.1 (Metastatic Prostate Adenocarcinoma Marker) (NKX3.1/2836), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF405S conjugate, 0.1mg/mL
BNC040035-500 1x 500 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2952), CF568 conjugate, 0.1mg/mL
BNC682952-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details