Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 1A2 (OR1A2), partial

This Recombinant Human Olfactory receptor 1A2 (OR1A2), partial spans the amino acid sequence from region 159-195. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 1A2; Olfactory receptor 17-6; OR17-6; Olfactory receptor OR17-10; OR1A2

UniProt

Q9Y585

Expression Region

159-195

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HTLLTASLSFCGNQEVANFYCDIMPLLKLSCSDVHFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Cortxin-3 ELISA Kit
MBS7207200-01 48 Well

Rat Cortxin-3 ELISA Kit

Sign In for Pricing
View Details
Rat Cortxin-3 ELISA Kit
MBS7207200-02 96 Well

Rat Cortxin-3 ELISA Kit

Sign In for Pricing
View Details
Rat Cortxin-3 ELISA Kit
MBS7207200-03 5x 96 Well

Rat Cortxin-3 ELISA Kit

Sign In for Pricing
View Details
Rat Cortxin-3 ELISA Kit
MBS7207200-04 10x 96 Well

Rat Cortxin-3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Corynebacterium aurimucosum Leucine--tRNA ligase (leuS), partial
MBS1191169 Inquire

Recombinant Corynebacterium aurimucosum Leucine--tRNA ligase (leuS), partial

Sign In for Pricing
View Details
KPRP siRNA (Human)
CRJ8343-01 15 nmol

KPRP siRNA (Human)

Sign In for Pricing
View Details