Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protocadherin gamma-B5 (PCDGH), partial

This Recombinant Human Protocadherin gamma-B5 (PCDGH), partial spans the amino acid sequence from region 31-687. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protocadherin gamma-B5; PCDH-gamma-B5; PCDHGB5

UniProt

Q9Y5G0

Expression Region

31-687

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EQIRYRIPEEMPKGSVVGNLATDLGFSVQELPTRKLRVSSEKPYFTVSAESGELLVSSRLDREEICGKKPACALEFEAVAENPLNFYHVNVEIEDINDHTPKFTQNSFELQISESAQPGTRFILEVAEDADIGLNSLQKYKLSLNPSFSLIIKEKQDGSKYPELALEKTLDREQQSYHRLVLTALDGGHPPLSGTTELRIQVTDANDNPPVFNRDVYRVSLRENVPPGTTVLQVSATDQDEGINSEITYSFYRTGQIFSLNSKSGEITTQKKLDFEETKEYSMVVEGRDGGGLVAQCTVEINIQDENDNSPEVTFHSLLEMILENAVPGTLIALIKIHDQDSGENGEVNCQLQGEVPFKIISSSKNSYKLVTDGTLDREQTPEYNVTITATDRGKPPLSSSISVILHIRDVNDNAPVFHQASYLVSVPENNPPGASIAQVCASDLDLGLNGQVSYSIMASDLEPLALASYVSMSAQSGVVFAQRAFDYEQLRTFELTLQARDQGSPALSANVSLRVLVGDRNDNAPRVLYPALGPDGSALFDMVPRAAEPGYLVTKVVAVDADSGHNAWLSYHVLQASEPGLFSLGLRTGEVRTARALGDRDAARQRLLVAVRDGGQPPLSATATLHLVFADSLQEVLPDITDRPVPSDPQAELQFY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL52 Antibody - N-terminal region (ARP70885_P050)
ARP70885_P050 100 µL

MRPL52 Antibody - N-terminal region (ARP70885_P050)

Sign In for Pricing
View Details
Mitoferrin-2 (SLC25A28) Human ELISA Kit
F0419 96 Tests

Mitoferrin-2 (SLC25A28) Human ELISA Kit

Sign In for Pricing
View Details
THAP4 Antibody
MBS9403248-01 0.1 mL

THAP4 Antibody

Sign In for Pricing
View Details
THAP4 Antibody
MBS9403248-02 5x 0.1 mL

THAP4 Antibody

Sign In for Pricing
View Details
Recombinant Murine soluble Tumor Necrosis Factor Receptor Type II/TNFRSF1B
P1346-.5 500 µg

Recombinant Murine soluble Tumor Necrosis Factor Receptor Type II/TNFRSF1B

Sign In for Pricing
View Details
PSMB4 Antibody
32983-01 50 µL

PSMB4 Antibody

Sign In for Pricing
View Details