Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 51B2 (O51B2), partial

This Recombinant Human Olfactory receptor 51B2 (O51B2), partial spans the amino acid sequence from region 159-194. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 51B2; Odorant receptor HOR5'beta3; Olfactory receptor 51B1; OR51B2 OR51B1P

UniProt

Q9Y5P1

Expression Region

159-194

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LRLFSFSYCKSHVITRAFCLHQEIMRLACADITFNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-14-3-3 alpha/beta Rabbit Monoclonal Antibody
MA1002-.05 50 µL

Anti-14-3-3 alpha/beta Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SEPT6 Protein Vector (Mouse) (pPB-N-His)
PV227839 500 ng

SEPT6 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
MIF4GD Human Over-expression Lysate
orb1376891 20 µg

MIF4GD Human Over-expression Lysate

Sign In for Pricing
View Details
FUS/TLS Double Nickase Plasmid (h)
sc-400612-NIC 20 µg

FUS/TLS Double Nickase Plasmid (h)

Sign In for Pricing
View Details
KRT14 Knockout HAP1 Polyclonal Cells
ARG34671 1 Million

KRT14 Knockout HAP1 Polyclonal Cells

Sign In for Pricing
View Details
Rabbit anti Rat FCAR  Monoclonal Antibody
MBS2544692-01 0.06 mL

Rabbit anti Rat FCAR  Monoclonal Antibody

Sign In for Pricing
View Details