Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKR (EIF2AK2) Human Gene Knockout Kit (CRISPR)
KN210792 1 Kit

PKR (EIF2AK2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Dideschloro Florfenicol-d3
TRC-D440502-25MG 25 mg

Dideschloro Florfenicol-d3

Sign In for Pricing
View Details
GLG1 (C-term) Rabbit Polyclonal Antibody
AP51850PU-N 400 µL

GLG1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS707668 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Santamarine
TRC-S124235-10MG 10 mg

Santamarine

Sign In for Pricing
View Details
PDCD10 Rabbit Polyclonal Antibody
TA379713 100 µL

PDCD10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details