Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3,4-Dichlorobenzyl bromide
TRC-D436523-250MG 250 mg

3,4-Dichlorobenzyl bromide

Sign In for Pricing
View Details
9,11-Anhydro Fusidic Acid
TRC-A639500-50MG 50 mg

9,11-Anhydro Fusidic Acid

Sign In for Pricing
View Details
LOC432576 Mouse Gene Knockout Kit (CRISPR)
KN517917 1 Kit

LOC432576 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DRAM (DRAM1) (N-term) Rabbit Polyclonal Antibody
AP08947PU-N 50 µg

DRAM (DRAM1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Dodecylresorcinol
TRC-D521185-500MG 500 mg

4-Dodecylresorcinol

Sign In for Pricing
View Details
Recombinant Human KLRB1/CD161 Protein (Fc Tag)
PKSH032676-01 10 µg

Recombinant Human KLRB1/CD161 Protein (Fc Tag)

Sign In for Pricing
View Details