Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42)

This Recombinant Human Probable non-functional immunoglobulin kappa variable 1D-42 (KVD42) spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin kappa variable 1D-42 IGKV1D-42

UniProt

A0A075B6H8

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DIQMTQSPSFLSASVGDRVSIICWASEGISSNLAWYLQKPGKSPKLFLYDAKDLHPGVSSRFSGRGSGTDFTLTIISLKPEDFAAYYCKQDFSYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Bmf Rabbit Monoclonal Antibody
M02432-1 100 µL/Vial

Anti-Bmf Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Human MKL1 (MKL/myocardin-like protein 1) ELISA Kit
EH10120 96 Tests

Human MKL1 (MKL/myocardin-like protein 1) ELISA Kit

Sign In for Pricing
View Details
Human MS4A3 Alexa Fluor 350 Antibody (Clone 489433)
FAB6247U-100UG 100 µg

Human MS4A3 Alexa Fluor 350 Antibody (Clone 489433)

Sign In for Pricing
View Details
Mouse Monoclonal CLGN Antibody (1C8B6)
NBP2-37348-0.025mL 0.025 mL

Mouse Monoclonal CLGN Antibody (1C8B6)

Sign In for Pricing
View Details
NPC2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11736R-BF555-TR 20 µL

NPC2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
NBMPR
2924/50 50 mg

NBMPR

Sign In for Pricing
View Details