Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-69 (LV469)

This Recombinant Human Immunoglobulin lambda variable 4-69 (LV469) spans the amino acid sequence from region 21-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-69 IGLV4-69

UniProt

A0A075B6H9

Expression Region

21-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLVLTQSPSASASLGASVKLTCTLSSGHSSYAIAWHQQQPEKGPRYLMKLNSDGSHSKGDGIPDRFSGSSSGAERYLTISSLQSEDEADYYCQTWGTGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ythdf3 3'UTR Lenti-reporter-Luc Vector
50640086 1.0 µg

Ythdf3 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
FITM2 Polyclonal Antibody, APC-Cy7 Conjugated
bs-23312R-APC-Cy7 100 µL

FITM2 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
CXorf49 (NM_001145140) Human Over-expression Lysate
LY428719 100 µg

CXorf49 (NM_001145140) Human Over-expression Lysate

Sign In for Pricing
View Details
RNASE2 Polyclonal Antibody
ANT-14176-50ug 50 µg

RNASE2 Polyclonal Antibody

Sign In for Pricing
View Details
Cystatin C Monoclonal Antibody, Cy5 Conjugated
bsm-43167M-Cy5 100 µL

Cystatin C Monoclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Echinococcus IgG ELISA
30113623 96 Determinations

Echinococcus IgG ELISA

Sign In for Pricing
View Details