Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861)

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861) spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL1B (Interleukin-1 beta, IL-1 beta, Catabolin, IL1F2) (MaxLight 550)
128426-ML550 100 µL

IL1B (Interleukin-1 beta, IL-1 beta, Catabolin, IL1F2) (MaxLight 550)

Sign In for Pricing
View Details
PPEF1 Rabbit Polyclonal Antibody (HRP)
orb2582183 100 µg

PPEF1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant3Cprotease, His, Human
orb1494911-01 100 IU

Recombinant3Cprotease, His, Human

Sign In for Pricing
View Details
Recombinant3Cprotease, His, Human
orb1494911-02 250 IU

Recombinant3Cprotease, His, Human

Sign In for Pricing
View Details
Recombinant3Cprotease, His, Human
orb1494911-03 500 IU

Recombinant3Cprotease, His, Human

Sign In for Pricing
View Details
FBXL6 Protein Vector (Rat) (pPM-C-His)
PV267961 500 ng

FBXL6 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details