Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 8-61 (LV861)

This Recombinant Human Immunoglobulin lambda variable 8-61 (LV861) spans the amino acid sequence from region 25-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 8-61 IGLV8-61

UniProt

A0A075B6I0

Expression Region

25-122

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QTVVTQEPSFSVSPGGTVTLTCGLSSGSVSTSYYPSWYQQTPGQAPRTLIYSTNTRSSGVPDRFSGSILGNKAALTITGAQADDESDYYCVLYMGSGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GDF5 ELISA Kit
orb565310-01 48 Tests

Mouse GDF5 ELISA Kit

Sign In for Pricing
View Details
Mouse GDF5 ELISA Kit
orb565310-02 96 Tests

Mouse GDF5 ELISA Kit

Sign In for Pricing
View Details
1 Clip Plate for 100ml Volumetric Flasks
MIX5194 1 Each

1 Clip Plate for 100ml Volumetric Flasks

Sign In for Pricing
View Details
Klk6 (NM_011177) Mouse Tagged ORF Clone
MG203095 10 µg

Klk6 (NM_011177) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Batroxobin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-2143R-BF405 100 µL

Batroxobin Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
ROCK1 antibody
20R-2902 100 ul

ROCK1 antibody

Sign In for Pricing
View Details