Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460)

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460) spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGFB3 Protein Vector (Human) (pPM-C-HA)
PV135552 500 ng

TGFB3 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Human Prostacyclin receptor (PTGIR) ELISA Kit
AE25234HU-01 48 Tests

Human Prostacyclin receptor (PTGIR) ELISA Kit

Sign In for Pricing
View Details
Human Prostacyclin receptor (PTGIR) ELISA Kit
AE25234HU-02 96 Tests

Human Prostacyclin receptor (PTGIR) ELISA Kit

Sign In for Pricing
View Details
NEUROG2 (Neurogenin 2, Atoh4, MGC46562, Math4A, NGN2, bHLHa8, ngn-2) (HRP)
249256-HRP 100 µL

NEUROG2 (Neurogenin 2, Atoh4, MGC46562, Math4A, NGN2, bHLHa8, ngn-2) (HRP)

Sign In for Pricing
View Details
Rat Samhd1 Pre-designed siRNA Set A
SI212399A 1 Each

Rat Samhd1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
IgG (HRP)
537779-01 100 µL

IgG (HRP)

Sign In for Pricing
View Details