Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 4-60 (LV460)

This Recombinant Human Immunoglobulin lambda variable 4-60 (LV460) spans the amino acid sequence from region 22-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 4-60 IGLV4-60

UniProt

A0A075B6I1

Expression Region

22-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QPVLTQSSSASASLGSSVKLTCTLSSGHSSYIIAWHQQQPGKAPRYLMKLEGSGSYNKGSGVPDRFSGSSSGADRYLTISNLQFEDEADYYCETWDSNT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Halofantrine HCl
279727-01 10 mg

Halofantrine HCl

Sign In for Pricing
View Details
Halofantrine HCl
279727-02 50 mg

Halofantrine HCl

Sign In for Pricing
View Details
GalNAc-T6 Double Nickase Plasmid (m)
sc-431525-NIC 20 µg

GalNAc-T6 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
UNG Recombinant Antibody
bsm-62212R-01 20 µL

UNG Recombinant Antibody

Sign In for Pricing
View Details
UNG Recombinant Antibody
bsm-62212R-02 100 µL

UNG Recombinant Antibody

Sign In for Pricing
View Details
Gpr61 Mouse Pre-designed siRNA Set A
HY-RS20943 1 Set

Gpr61 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details