Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55)

This Recombinant Human Probable non-functional immunoglobulin lambda variable 11-55 (LVK55) spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 11-55 IGLV11-55

UniProt

A0A075B6I3

Expression Region

20-123

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RPVLTQPPSLSASPGATARLPCTLSSDLSVGGKNMFWYQQKLGSSPRLFLYHYSDSDKQLGPGVPSRVSGSKETSSNTAFLLISGLQPEDEADYYCQVYESSAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TTC30A shRNA Plasmid (h)
sc-94900-SH 20 µg

TTC30A shRNA Plasmid (h)

Sign In for Pricing
View Details
Gm5494 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3195908 1.0 µg DNA

Gm5494 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral human FOXF1 shRNA (UAS) - Lentiviral human FOXF1 shRNA (UAS, RFP) (100)
GTR15096972 1 Vial

Lentiviral human FOXF1 shRNA (UAS) - Lentiviral human FOXF1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Human Ubiquitin (Ub) ELISA Kit
GA-E1635HM-01 48 Tests

Human Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
Human Ubiquitin (Ub) ELISA Kit
GA-E1635HM-02 96 Tests

Human Ubiquitin (Ub) ELISA Kit

Sign In for Pricing
View Details
2-[2-[2-[2-[2-[2-[2- (2-Hydroxyethoxy) ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethyl 2-methylprop-2-enoate
OR1076913-01 100 mg

2-[2-[2-[2-[2-[2-[2- (2-Hydroxyethoxy) ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethoxy]ethyl 2-methylprop-2-enoate

Sign In for Pricing
View Details