Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54)

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54) spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Huntingtin (HTT) CytoSection
TS418435P5 25 Slides

Huntingtin (HTT) CytoSection

Sign In for Pricing
View Details
Pyrroline-5-Carboxylate Reductase 1, Mitochondrial (PYCR1) Antibody
abx236969 100 µg

Pyrroline-5-Carboxylate Reductase 1, Mitochondrial (PYCR1) Antibody

Sign In for Pricing
View Details
GRM6 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
22696154 3x 1.0 µg DNA

GRM6 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Sval2 AAV siRNA Pooled Vector
45922166 1.0 µg

Sval2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
GENLISA™ Human NACHT, LRR and PYD domains-containing Protein 3, NLRP3 / C1orf7 / CIAS1 / NALP3 / PYPAF1 ELISA
KBH3980 96 Well

GENLISA™ Human NACHT, LRR and PYD domains-containing Protein 3, NLRP3 / C1orf7 / CIAS1 / NALP3 / PYPAF1 ELISA

Sign In for Pricing
View Details
ABHD6 (NM_020676) Human Recombinant Protein
E45H41741M5 20 µg

ABHD6 (NM_020676) Human Recombinant Protein

Sign In for Pricing
View Details