Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54)

This Recombinant Human Immunoglobulin lambda variable 10-54 (LVX54) spans the amino acid sequence from region 22-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 10-54 IGLV10-54

UniProt

A0A075B6I4

Expression Region

22-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GLTQPPSVSKGLRQTATLTCTGNSNIVGNQGAAWLQQHQGHPPKLLSYRNNNRPSGISERFSASRSGNTASLTITGLQPEDEADYYCSALDSSLSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CED6 Polyclonal Antibody, HRP Conjugated
bs-13626R-HRP 100 µL

CED6 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Recombinant Human UTP15 Protein - (Dry Ice)
H00084135-P01-10ug 10 µg

Recombinant Human UTP15 Protein - (Dry Ice)

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF405S conjugate, 0.1mg/mL
BNC042501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LYPLA3 (PLA2G15) (NM_012320) Human Over-expression Lysate
E45H08774-2 20 µg

LYPLA3 (PLA2G15) (NM_012320) Human Over-expression Lysate

Sign In for Pricing
View Details
Tmco5b Rabbit Polyclonal Antibody
TA363544 100 µL

Tmco5b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GSTa5 (Glutathione S Transferase Alpha 5) ELISA Kit
MBS8800717-01 48 Well

Human GSTa5 (Glutathione S Transferase Alpha 5) ELISA Kit

Sign In for Pricing
View Details